PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_5070V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 321aa    MW: 35940 Da    PI: 4.8538
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_5070V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-162168148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+ Ed++l ++v+++G ++W+ I+++ g+ R +k+c++rw +yl
  Pp3c13_5070V3.2.p 21 KGPWTEAEDKILTECVEKYGDRCWRQIPKHGGLLRDGKSCRLRWKNYL 68
                       79******************************99************97 PP

2Myb_DNA-binding54.42.8e-1774119148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg+++++Ede ++ ++++lG++ W++Ia +++ gRt++++k++w+++l
  Pp3c13_5070V3.2.p  74 RGKFSKDEDEFIITLHALLGNR-WSLIAGRIP-GRTDNEIKNHWNTHL 119
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5851668IPR017930Myb domain
SuperFamilySSF466891.04E-2819115IPR009057Homeodomain-like
SMARTSM007171.1E-132070IPR001005SANT/Myb domain
PfamPF002499.2E-152168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-222275IPR009057Homeodomain-like
CDDcd001679.69E-122368No hitNo description
PROSITE profilePS5129427.07869123IPR017930Myb domain
SMARTSM007179.5E-1773121IPR001005SANT/Myb domain
PfamPF002497.4E-1674119IPR001005SANT/Myb domain
CDDcd001671.09E-1276119No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2576123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGLFLDRCKS RRSGGTDPVS KGPWTEAEDK ILTECVEKYG DRCWRQIPKH GGLLRDGKSC  60
RLRWKNYLKP GLKRGKFSKD EDEFIITLHA LLGNRWSLIA GRIPGRTDNE IKNHWNTHLK  120
KRLREMGIDH ENHSVGLKLS SDSDGSLDAE ESKGKNVEDQ RGWPSPSFDD IAQCADNLYT  180
NPQNVDPLPQ EFLSPGDSLL HCQFDTGLEF ESTFNCQVDQ GPYTDDPCSS ASCTYDNGLS  240
GLEQPCPKLP QSENSLDFNL EKSLGSSFKT YPSPTDRLAF DMMDYLPLSL MGLSGFAEES  300
PHEDDVSGPL WTSIQLFDHS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29151231108B-MYB
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.15440.0gametophore
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S133_87V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.14e-50myb domain protein 6